PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN540057.1_FGP006
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 512aa    MW: 56432.5 Da    PI: 6.5484
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN540057.1_FGP006genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS238.92.2e-732524862239
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                        ++++ +c +av++++    + l+++l++++s +g+pmqRl ay++e+L arl+++++ lyk+l+++e +   s e +++++l++e++P++kf
  KN540057.1_FGP006 252 KQVIAACGKAVDENS-WYRDLLMSELRNMVSISGEPMQRLGAYMLEGLVARLSSTGHALYKSLKCKEPT---SFELMSYMHLLYEICPFFKF 339
                        677888999998854.5568899*********************************************9...99999*************** PP

               GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlva 183
                        +++ aN aI eav+ge+ vHiiDf+i qG QW++++qaLa+Rp+gpp lRiTg+++++s   +   l  +g+rL ++A+++g+pfefn+ v 
  KN540057.1_FGP006 340 GYMSANGAIAEAVKGENFVHIIDFQIAQGSQWATMIQALAARPGGPPYLRITGIDDSNSAhaRGGGLDIVGRRLFNIAQSCGLPFEFNA-VP 430
                        ********************************************************8888889999***********************.79 PP

               GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvv 239
                         + +++ le+L++++gE+++Vn+++qlh+++desv +e++rd++L++vk+lsP+vv
  KN540057.1_FGP006 431 AASHEVMLEHLDIRSGEVIVVNFAYQLHHTPDESVGIENHRDRILRMVKGLSPRVV 486
                        9999999************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.544225512IPR005202Transcription factor GRAS
PfamPF035147.5E-71252486IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 512 aa     Download sequence    Send to blast
MACRIEVWPP SATAGRSCLF ISRSGGGGGE QPGRLYNLLR EEILLTEIWN SDNNGKINSL  60
LIVRKCIIPQ RLQHINKIQK VAPENMSMQA SNRPYRYPDN SQIPYYSRSS MHVGQNGTYH  120
VQQNHEDLYA SSDDGSQNGN SKAQGLQAQY CTLDSSLGNF VYPAHSSTSS HISGSPISQQ  180
DSHSEHTSGS PASASCVTEV PGLRFTTIEE IENAMFGPEP DTVSSDCSLL TDSAFYQDNW  240
REHLGINTGD LKQVIAACGK AVDENSWYRD LLMSELRNMV SISGEPMQRL GAYMLEGLVA  300
RLSSTGHALY KSLKCKEPTS FELMSYMHLL YEICPFFKFG YMSANGAIAE AVKGENFVHI  360
IDFQIAQGSQ WATMIQALAA RPGGPPYLRI TGIDDSNSAH ARGGGLDIVG RRLFNIAQSC  420
GLPFEFNAVP AASHEVMLEH LDIRSGEVIV VNFAYQLHHT PDESVGIENH RDRILRMVKG  480
LSPRVVQKGW RGTSLLENGG QGFQWLALGR TH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-292484991250GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2104800.0AC210480.2 Oryza glaberrima clone OG_BBa0067M08, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630858.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_015630859.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_015630860.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_015630861.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_015630862.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_015630863.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ8GVE11e-132CIGR2_ORYSJ; Chitin-inducible gibberellin-responsive protein 2
TrEMBLB8AQ190.0B8AQ19_ORYSI; Putative uncharacterized protein
TrEMBLI1P8G00.0I1P8G0_ORYGL; Uncharacterized protein
TrEMBLQ10QK30.0Q10QK3_ORYSJ; Chitin-inducible gibberellin-responsive protein 2, putative, expressed
STRINGBGIOSGA012030-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os03g09280.10.0(Oryza sativa Japonica Group)
STRINGORGLA03G0065600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP151337117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.21e-112GRAS family protein